PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC040945.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 163aa    MW: 18234.3 Da    PI: 8.7096
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC040945.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.37.8e-17741135
          GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                  C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  EcC040945.10  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                  ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.2E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.47E-12546No hitNo description
CDDcd002028.54E-17655No hitNo description
PfamPF003201.3E-14741IPR000679Zinc finger, GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-13741IPR013088Zinc finger, NHR/GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLANYTPLHA RAEPGDYEDH  60
RFGRGKNISI NINKNKEVKV PKRKQYPDDM VFGGIMSDYN QGFQKFIDDD TSNRSSSGSA  120
ISNSDAQFGS ADASDLTGWT SISYLWEYVF LVLQNKRTCS SFF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053539.11e-91PREDICTED: GATA transcription factor 26-like isoform X1
SwissprotQ8W4H14e-48GAT26_ARATH; GATA transcription factor 26
TrEMBLA0A059CHC91e-91A0A059CHC9_EUCGR; Uncharacterized protein
STRINGPOPTR_0003s08080.11e-67(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16062785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-43GATA transcription factor 26